Overview

  • Product name

    Recombinant Human HIRIP3 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAREKEMQEFTRSFFRGRPDLSTLTHSIVRRRYLAHSGRSHLEPEEKQAL KRLVEEELLKMQVDEAASREDKLDLTKKGKRPPTPCSDPERKRFRFNSES ESGSEASSPDYFGPPAKNGVAAEVSPAKEENPRRASKAVEESSDEERQRD LPAQRGEESSEEEEKGYKGKTRKKPVVKKQAPGKASVSRKQAREESEESE AEPVQRTAKKVEGNKGTKSLKESEQESEEEILAQKKEQREEEVEEEEKEE DEEKGDWKPRTRSNGRRKSAREERSCKQKSQAKRLLGDSDSEEEQKEAAS SGDDSGRDREPPVQRKSEDRTQLKGGKRLSGSSEDEEDSGKGEPTAKGSR KMARLGSTSGEESDLEREVSDSEAGGGPQGERKNRSSKKSSRKGRTRSSS SSSDGSPEAKGGKAGSGRRGEDHPAVMRLKRYIRACGAHRNYKKLLGSCC SHKERLSILRAELEALGMKGTPSLGKCRALKEQREEAAEVASLDVANIIS GSGRPRRRTAWNPLGEAAPPGELYRRTLDSDEERPRPAPPDWSHMRGIIS SDGESN
    • Molecular weight

      88 kDa including tags
    • Amino acids

      1 to 556

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132409 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HIRA-interacting protein 3
    • HIRIP3
    • HIRP3
    • HIRP3_HUMAN
  • Function

    May play a role in chromatin function and histone metabolism via its interaction with HIRA and histones.
  • Tissue specificity

    Widely expressed. Isoform 1 is predominant in skeletal muscle. Isoform 2 is predominant in liver and heart.
  • Post-translational
    modifications

    Phosphorylated by CK2.
  • Cellular localization

    Nucleus. Nuclear throughout the cell cycle and is excluded from condensed chromatin during mitosis.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132409, stained with Coomassie Blue.

References

ab132409 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132409.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up