Description

  • Product name

    Recombinant Human Histatin-3 protein (Tagged)
  • Purity

    > 95 % SDS-PAGE.
    ab199580 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLVPRGSENLYFQGHMDSHAKRHHGYKRKFH EKHHSHRGYRSNYLYDN
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      20 to 51
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      This is the full length mature protein without the signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab199580 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 1.16% Sodium chloride, 0.32% Tris HCl

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Basic histidine-rich protein
    • HIS3
    • His3 1/11
    • His3 1/12
    • His3 1/13
    • His3 1/24
    • His3 1/25
    • His3 12/24
    • His3 12/25
    • His3 12/32
    • His3 13/24
    • His3 13/25
    • His3 14/24
    • His3 14/25
    • His3 15/24
    • His3 15/25
    • His3 20/30
    • His3 20/31
    • His3 20/32
    • His3 20/43
    • His3 20/44
    • His3 24/30
    • His3 24/31
    • His3 24/32
    • His3 25/30
    • His3 25/32
    • His3 26/30
    • His3 26/31
    • His3 26/32
    • His3 28/32
    • His3 29/32
    • His3 31/43
    • His3 31/44
    • His3 31/51
    • His3 32-43
    • His3 32/44
    • His3 33/43
    • His3 33/44
    • His3 34/43
    • His3 34/44
    • His3 45/51
    • His3 47/51
    • His3 48/51
    • His3 5/11
    • His3 5/12
    • His3 5/13
    • His3 6/11
    • His3 6/13
    • His3 7/11
    • His3 7/12
    • His3 7/13
    • His3-(1-11)-peptide
    • His3-(1-12)-peptide
    • His3-(1-13)-peptide
    • His3-(1-24)-peptide
    • His3-(1-25)-peptide
    • His3-(12-24)-peptide
    • His3-(12-25)-peptide
    • His3-(12-32)-peptide
    • His3-(13-24)-peptide
    • His3-(13-25)-peptide
    • His3-(14-24)-peptide
    • His3-(14-25)-peptide
    • His3-(15-24)-peptide
    • His3-(15-25)-peptide
    • His3-(26-32)-peptide
    • His3-(28-32)-peptide
    • His3-(29-32)-peptide
    • His3-(48-51)-peptide
    • His3-(5-11)-peptide
    • His3-(5-12)-peptide
    • His3-(5-13)-peptide
    • His3-(6-11)-peptide
    • His3-(6-13)-peptide
    • His3-(7-11)-peptide
    • His3-(7-12)-peptide
    • His3-(7-13)-peptide
    • HIS3_HUMAN
    • Histatin 3
    • Histatin-10
    • Histatin-11
    • Histatin-12
    • Histatin-3 1/11
    • Histatin-3 1/12
    • Histatin-3 1/13
    • Histatin-3 1/24
    • Histatin-3 1/25
    • Histatin-3 12/24
    • Histatin-3 12/25
    • Histatin-3 12/32
    • Histatin-3 13/24
    • Histatin-3 13/25
    • Histatin-3 14/24
    • Histatin-3 14/25
    • Histatin-3 15/24
    • Histatin-3 15/25
    • Histatin-3 26/32
    • Histatin-3 28/32
    • Histatin-3 29/32
    • Histatin-3 5/11
    • Histatin-3 5/12
    • Histatin-3 5/13
    • Histatin-3 6/11
    • Histatin-3 6/13
    • Histatin-3 7/11
    • Histatin-3 7/12
    • Histatin-3 7/13
    • Histatin-4
    • Histatin-5
    • Histatin-6
    • Histatin-7
    • Histatin-8
    • Histatin-9
    • Histidine-rich protein 3
    • Hst
    • HTN3
    • HTN5
    • NTN2
    • PB
    see all
  • Function

    Histatins are salivary proteins that are considered to be major precursors of the protective proteinaceous structure on tooth surfaces (enamel pellicle). In addition, histatins exhibit antibacterial and antifungal activities. His3-(20-43)-peptide (histatin-5) is especially effective against C.albicans and C.neoformans, and inhibits Lys-gingipain and Arg-gingipain (rgpB) from P.gingivalis. In addition, His3-(20-43)-peptide is a potent inhibitor of metalloproteinases MMP2 and MMP9.
  • Sequence similarities

    Belongs to the histatin/statherin family.
  • Post-translational
    modifications

    24 proteolytic products are found in saliva.
  • Cellular localization

    Secreted. Secreted by serous acinar and demilune cells.
  • Information by UniProt

References

ab199580 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab199580.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up