Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKD VSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK
    • Amino acids
      81 to 179
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Histone acetyltransferase MYST3.  

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HAT 3
    • Histone acetyltransferase MYST3
    • Monocytic leukemia zinc finger protein
    • MOZ
    • MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3
    • MYST histone acetyltransferase (monocytic leukemia) 3
    • MYST protein 3
    • MYST-3
    • MYST3
    • MYST3_HUMAN
    • OTTHUMP00000197392
    • OTTHUMP00000197394
    • OTTHUMP00000225722
    • Runt related transcription factor binding protein 2
    • Runt-related transcription factor-binding protein 2
    • RUNXBP2
    • SAS2
    • SAS2 and TIP60 protein 3
    • TIP60 protein 3
    • YBF2/SAS3
    • ZC2HC6A
    • Zinc finger protein 220
    • ZNF220
    see all
  • Function
    Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2.
  • Involvement in disease
    Note=Chromosomal aberrations involving MYST3 may be a cause of acute myeloid leukemias. Translocation t(8;16)(p11;p13) with CREBBP; translocation t(8;22)(p11;q13) with EP300. MYST3-CREBBP may induce leukemia by inhibiting RUNX1-mediated transcription. Inversion inv(8)(p11;q13) generates the MYST3-NCOA2 oncogene, which consists of the N-terminus part of MYST3/MOZ and the C-terminus part of NCOA2/TIF2. MYST3-NCOA2 binds to CREBBP and disrupts its function in transcription activation.
    Note=A chromosomal aberration involving MYST3 is a cause of therapy-related myelodysplastic syndrome. Translocation t(2;8)(p23;p11.2) with ASXL2 generates a MYST3-ASXL2 fusion protein.
  • Sequence similarities
    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
    Contains 1 H15 (linker histone H1/H5 globular) domain.
    Contains 2 PHD-type zinc fingers.
  • Domain
    The N-terminus is involved in transcriptional activation while the C-terminus is involved in transcriptional repression.
  • Post-translational
    modifications
    Autoacetylated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Partially concentrated in subnuclear foci distinct from PML bodies, and excluded from the nucleoli.
  • Information by UniProt

Images

  • ab159926 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up