Recombinant Human Histone acetyltransferase MYST3/MOZ protein (ab159926)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human Histone acetyltransferase MYST3/MOZ protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKSIERFLKGQKD VSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGK -
Amino acids
81 to 179 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab159926 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as Histone acetyltransferase MYST3.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- HAT 3
- Histone acetyltransferase MYST3
- Monocytic leukemia zinc finger protein
see all -
Function
Histone acetyltransferase that acetylates lysine residues in histone H3 and histone H4 (in vitro). Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May act as a transcriptional coactivator for RUNX1 and RUNX2. -
Involvement in disease
Note=Chromosomal aberrations involving MYST3 may be a cause of acute myeloid leukemias. Translocation t(8;16)(p11;p13) with CREBBP; translocation t(8;22)(p11;q13) with EP300. MYST3-CREBBP may induce leukemia by inhibiting RUNX1-mediated transcription. Inversion inv(8)(p11;q13) generates the MYST3-NCOA2 oncogene, which consists of the N-terminus part of MYST3/MOZ and the C-terminus part of NCOA2/TIF2. MYST3-NCOA2 binds to CREBBP and disrupts its function in transcription activation.
Note=A chromosomal aberration involving MYST3 is a cause of therapy-related myelodysplastic syndrome. Translocation t(2;8)(p23;p11.2) with ASXL2 generates a MYST3-ASXL2 fusion protein. -
Sequence similarities
Belongs to the MYST (SAS/MOZ) family.
Contains 1 C2HC-type zinc finger.
Contains 1 H15 (linker histone H1/H5 globular) domain.
Contains 2 PHD-type zinc fingers. -
Domain
The N-terminus is involved in transcriptional activation while the C-terminus is involved in transcriptional repression. -
Post-translational
modificationsAutoacetylated.
Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Nucleus. Partially concentrated in subnuclear foci distinct from PML bodies, and excluded from the nucleoli. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab159926 has not yet been referenced specifically in any publications.