Description

  • Product name

    Recombinant Human Histone H2A-Bbd protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVL ELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
    • Amino acids

      19 to 115
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Also SwissProt ID: P0C5Y9

Specifications

Our Abpromise guarantee covers the use of ab164435 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • H2A Barr body deficient
    • H2A Barr body-deficient
    • H2A histone family member B
    • H2A.Bbd
    • H2AB2_HUMAN
    • H2ABBD
    • H2AFB
    • H2AFB1
    • H2AFB2
    • H2AFB3
    • Histone H2A BBD
    • Histone H2A-Bbd type 1
    • Histone H2A-Bbd type 2/3
    see all
  • Function

    Atypical histone H2A which can replace conventional H2A in some nucleosomes and is associated with active transcription and mRNA processing. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. Nucleosomes containing this histone are less rigid and organize less DNA than canonical nucleosomes in vivo. They are enriched in actively transcribed genes and associate with the elongating form of RNA polymerase. They associate with spliceosome components and are required for mRNA splicing. May participate in spermatogenesis.
  • Tissue specificity

    Present in mature sperm.
  • Sequence similarities

    Belongs to the histone H2A family.
  • Domain

    The docking domain is responsible for the weaker heterodimerization with H2B.
  • Cellular localization

    Nucleus. Chromosome. Associated with the active X chromosome and with autosomes, while it is absent from the inactive X chromosome and excluded from Barr bodies.
  • Information by UniProt

Images

  • ab164435 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164435 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164435.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up