For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-histone-h2a-biotinylated--protein-ab200286.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Share by email

Recombinant Human Histone H2A (biotinylated ) protein (ab200286)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human Histone H2A (biotinylated ) protein (ab200286)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 56% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE

    You may also be interested in

    Primary
    Product image
    Anti-Histone H2A antibody - ChIP Grade (ab18255)
    Primary
    Product image
    Anti-Histone H2A (acetyl K5) antibody [EP856Y] (ab45152)
    Primary
    Product image
    Anti-Histone H2A antibody - ChIP Grade (ab88770)

    View more associated products

    Description

    • Product name

      Recombinant Human Histone H2A (biotinylated ) protein
      See all Histone H2A proteins and peptides
    • Purity

      > 56 % SDS-PAGE.

    • Expression system

      Escherichia coli
    • Accession

      Q7L7L0
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERV GAGAPV YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDE ELNKLLGRVTIAQGGVLPNI QAVLLPKKTESHHKAKGKC
      • Predicted molecular weight

        15 kDa including tags
      • Amino acids

        2 to 130
      • Modifications

        biotinylated
      • Tags

        His tag N-Terminus
      • Additional sequence information

        Biotinylated Human Histone 2A without initiator Methionine and with C-terminal Cysteine.

    Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-Histone H2A antibody - ChIP Grade (ab18255)
      • Anti-Histone H2A (acetyl K5) antibody [EP856Y] (ab45152)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-Histone H2A antibody - ChIP Grade (ab88770)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab200286 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

      pH: 7.40
      Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% (R*,R*)-1,4-Dimercaptobutan-2,3-diol, 20% Glycerol (glycerin, glycerine)

    General Info

    • Alternative names

      • H2A
      • H2a 615
      • H2A GL101
      • H2A histone family member A
      • H2A.1
      • H2A.2
      • H2A/a
      • H2A/m
      • H2A/O
      • H2A/q
      • H2A1B_HUMAN
      • H2AFA
      • H2AFE
      • H2AFL
      • H2AFM
      • H2AFO
      • H2AFQ
      • HIST1H2AE
      • HIST1H2AJ
      • HIST2H2AA
      • HIST2H2AA3
      • HIST2H2AB
      • HIST2H2AC
      • Histone 1 H2ae
      • Histone 2 H2aa3
      • Histone 2 H2ab
      • Histone 2 H2ac
      • Histone H2A type 1 B
      • Histone H2A type 1 C
      • Histone H2A type 1 E
      • Histone H2A type 1 J
      • Histone H2A type 1-B/E
      • Histone H2A.2
      • Histone H2A/a
      • Histone H2A/m
      • MGC74460
      see all
    • Function

      Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
    • Sequence similarities

      Belongs to the histone H2A family.
    • Post-translational
      modifications

      The chromatin-associated form is phosphorylated on Thr-121 during mitosis.
      Deiminated on Arg-4 in granulocytes upon calcium entry.
      Monoubiquitination of Lys-120 by RING1 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. It is involved in the initiation of both imprinted and random X inactivation. Ubiquitinated H2A is enriched in inactive X chromosome chromatin. Ubiquitination of H2A functions downstream of methylation of 'Lys-27' of histone H3. Monoubiquitination of Lys-120 by RNF2/RING2 can also be induced by ultraviolet and may be involved in DNA repair. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Monoubiquitination and ionizing radiation-induced 'Lys-63'-linked ubiquitination are distinct events.
      Phosphorylation on Ser-2 is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1.
      Symmetric dimethylation on Arg-4 by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage.
    • Cellular localization

      Nucleus. Chromosome.
    • Target information above from: UniProt accession P04908 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human Histone H2A (biotinylated ) protein (ab200286)
      SDS-PAGE - Recombinant Human Histone H2A (biotinylated ) protein (ab200286)

      Lane 1: 4-20% SDS-PAGE Coomassie staining using 2 µg ab200286

      Lane 2: Marker

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet download

      Download

    References (1)

    Publishing research using ab200286? Please let us know so that we can cite the reference in this datasheet.

    ab200286 has been referenced in 1 publication.

    • Beltran M  et al. G-tract RNA removes Polycomb repressive complex 2 from genes. Nat Struct Mol Biol 26:899-909 (2019). PubMed: 31548724

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab200286.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.