Recombinant Human Histone H2A (biotinylated ) protein (ab200286)
Key features and details
- Expression system: Escherichia coli
- Purity: > 56% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human Histone H2A (biotinylated ) protein
See all Histone H2A proteins and peptides -
Purity
> 56 % SDS-PAGE. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERV GAGAPV YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDE ELNKLLGRVTIAQGGVLPNI QAVLLPKKTESHHKAKGKC -
Predicted molecular weight
15 kDa including tags -
Amino acids
2 to 130 -
Modifications
biotinylated -
Tags
His tag N-Terminus -
Additional sequence information
Biotinylated Human Histone 2A without initiator Methionine and with C-terminal Cysteine.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab200286 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol
General Info
-
Alternative names
- H2A
- H2a 615
- H2A GL101
see all -
Function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. -
Sequence similarities
Belongs to the histone H2A family. -
Post-translational
modificationsThe chromatin-associated form is phosphorylated on Thr-121 during mitosis.
Deiminated on Arg-4 in granulocytes upon calcium entry.
Monoubiquitination of Lys-120 by RING1 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. It is involved in the initiation of both imprinted and random X inactivation. Ubiquitinated H2A is enriched in inactive X chromosome chromatin. Ubiquitination of H2A functions downstream of methylation of 'Lys-27' of histone H3. Monoubiquitination of Lys-120 by RNF2/RING2 can also be induced by ultraviolet and may be involved in DNA repair. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Monoubiquitination and ionizing radiation-induced 'Lys-63'-linked ubiquitination are distinct events.
Phosphorylation on Ser-2 is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1.
Symmetric dimethylation on Arg-4 by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage. -
Cellular localization
Nucleus. Chromosome. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human Histone H2A (biotinylated ) protein (ab200286)Lane 1: 4-20% SDS-PAGE Coomassie staining using 2 µg ab200286
Lane 2: Marker
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab200286 has not yet been referenced specifically in any publications.
