Recombinant Human Histone H2A (biotinylated ) protein (ab200286)

Description

  • Product name

    Recombinant Human Histone H2A (biotinylated ) protein
    See all Histone H2A proteins and peptides
  • Purity

    > 56 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERV GAGAPV YLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDE ELNKLLGRVTIAQGGVLPNI QAVLLPKKTESHHKAKGKC
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      2 to 130
    • Modifications

      biotinylated
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Biotinylated Human Histone 2A without initiator Methionine and with C-terminal Cysteine.

Specifications

Our Abpromise guarantee covers the use of ab200286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

General Info

  • Alternative names

    • H2A
    • H2a 615
    • H2A GL101
    • H2A histone family member A
    • H2A.1
    • H2A.2
    • H2A/a
    • H2A/m
    • H2A/O
    • H2A/q
    • H2A1B_HUMAN
    • H2AFA
    • H2AFE
    • H2AFL
    • H2AFM
    • H2AFO
    • H2AFQ
    • HIST1H2AE
    • HIST1H2AJ
    • HIST2H2AA
    • HIST2H2AA3
    • HIST2H2AB
    • HIST2H2AC
    • Histone 1 H2ae
    • Histone 2 H2aa3
    • Histone 2 H2ab
    • Histone 2 H2ac
    • Histone H2A type 1 B
    • Histone H2A type 1 C
    • Histone H2A type 1 E
    • Histone H2A type 1 J
    • Histone H2A type 1-B/E
    • Histone H2A.2
    • Histone H2A/a
    • Histone H2A/m
    • MGC74460
    see all
  • Function

    Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
  • Sequence similarities

    Belongs to the histone H2A family.
  • Post-translational
    modifications

    The chromatin-associated form is phosphorylated on Thr-121 during mitosis.
    Deiminated on Arg-4 in granulocytes upon calcium entry.
    Monoubiquitination of Lys-120 by RING1 and RNF2/RING2 complex gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. It is involved in the initiation of both imprinted and random X inactivation. Ubiquitinated H2A is enriched in inactive X chromosome chromatin. Ubiquitination of H2A functions downstream of methylation of 'Lys-27' of histone H3. Monoubiquitination of Lys-120 by RNF2/RING2 can also be induced by ultraviolet and may be involved in DNA repair. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties by the E2 ligase UBE2N and the E3 ligases RNF8 and RNF168, leading to the recruitment of repair proteins to sites of DNA damage. Monoubiquitination and ionizing radiation-induced 'Lys-63'-linked ubiquitination are distinct events.
    Phosphorylation on Ser-2 is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1.
    Symmetric dimethylation on Arg-4 by the PRDM1/PRMT5 complex may play a crucial role in the germ-cell lineage.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt

Images

  • Lane 1: 4-20% SDS-PAGE Coomassie staining using 2 µg ab200286

    Lane 2: Marker

References

ab200286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up