Recombinant Human Histone Octamer protein (ab216230)

Description

  • Product name

    Recombinant Human Histone Octamer protein
    See all Histone Octamer proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      SGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVY LAAVLEYLTA EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLG RVTIAQGGVLPNIQAVLLPKKT ESHHKAKGK
    • Amino acids

      2 to 130
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_033445).
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHP DTGISSKAMG IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAV RLLLPGELAKHAVSEGTKAVTK YTSSK
    • Amino acids

      2 to 126
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_003528).
    • Amino Acid Sequence 3

    • Species

      Human
    • Sequence

      ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE IRRYQKSTEL LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEA YLVGLFEDTNLCAIHAKRVTIM PKDIQLARRIRGERA
    • Amino acids

      2 to 136
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_003532).
    • Amino Acid Sequence 4

    • Species

      Human
    • Sequence

      SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLI YEETRGVLKV FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY GFGG
    • Amino acids

      2 to 103
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NM_003548). Global MW = 113.8 kDa.

Specifications

Our Abpromise guarantee covers the use of ab216230 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Storing  diluted  protein  is not  recommended,  if  necessary,  use  carrier protein (BSA 0.1 – 0.5%).

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 0.12% Tris, 11.6% Sodium chloride, 0.03% EDTA, 0.05% Beta mercaptoethanol, 10% Glycerol

General Info

  • Relevance

    The Histone Octamer is composed of a central heterotetramer of two copies of both histones H3 and H4, flanked by two heterodimers of histones H2A and H2B. The octamer assembles when the H3/H4 tetramer complexes with two H2A/H2B dimers. These histones of the histone octamer all contain N-terminal tails that emanate from their central histone folds and are targets for epigenetic modification.

Images

  • 4-20% SDS-PAGE analysis of ab216230 (2 µg Octamer).

References

ab216230 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216230.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up