Overview

  • Product name
    Recombinant Human HIV-1 gp120 (CN54) protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TVYYGVPVWKEAKTTLFCASDAKAYEKEVHNVWATHACVPTDPNPQEMVL ENVTENFNMWKNDMVEQMHEDVISLWDQSLKPCVKLTPLCVTLECRQVNT TNATSSVNVTNGEEIKNCSFNATTEIRDKKQKVYALFYRLDIVPLEEERK GNSSKYRLINCNTSAITQACPKVTFDPIPIHYCAPAGYAILKCNNKTFNG TGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLTNNVKTII VHLNESVEIVCTRPNNNTRKSIRIGPGQTFYATGDIIGNIRQAYCNIKKD DWIRTLQRVGKKLAEHFPRRIINFTSPAGGDLEITTHSFNCRGEFFYCNT SSLFNSTYNPNDTNSNSSSSNSSLDITIPCRIKQIINMWQEVGRAMYAPP IEGNITCKSNITGLLLVRDGGVESNETEIFRPGGGDMRNNWRSELYKYKV VEIKPLGIAPTAAKRRVVEREKR
    • Molecular weight
      54 kDa including tags
    • Amino acids
      34 to 506
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Aliquot to avoid repeated freeze-thaw cycles.

General Info

  • Alternative names
    • Envelope glycoprotein gp160
  • Relevance
    The envelope glyprotein gp160 precursor down-modulates cell surface CD4 antigen by interacting with it in the endoplasmic reticulum and blocking its transport to the cell surface By similarity. The gp120-gp41 heterodimer allows rapid transcytosis of the virus through CD4 negative cells such as simple epithelial monolayers of the intestinal, rectal and endocervical epithelial barriers. Both gp120 and gp41 specifically recognize glycosphingolipids galactosyl-ceramide (GalCer) or 3' sulfo-galactosyl-ceramide (GalS) present in the lipid rafts structures of epithelial cells. Binding to these alternative receptors allows the rapid transcytosis of the virus through the epithelial cells. This transcytotic vesicle-mediated transport of virions from the apical side to the basolateral side of the epithelial cells does not involve infection of the cells themselves.

Images

  • SDS-PAGE analysis of reduced ab174070 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 65-110 kDa due to glycosylation.

References

ab174070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up