Description

  • Product name

    Recombinant Human HLA B protein (His tag)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAP WIEQEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYG CDVGPDGRLLRGHDQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA REAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP SGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTIPI
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      25 to 308
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab225646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • 1B07_HUMAN
    • AS
    • B-4901
    • B-7 alpha chain
    • HC class I antigen SHCHA
    • HLA class I histocompatibility antigen
    • HLA class I histocompatibility antigen, B alpha chain
    • HLA-B
    • HLA-B histocompatibility type
    • HLAB
    • leukocyte antigen class I-B
    • major histocompatibility complex, class I, B
    • MHC class 1 antigen
    • MHC class I antigen B*7
    • MHC class I antigen HLA-B alpha chain
    • MHC class I antigen HLA-B heavy chain
    • MHC Class I HLA heavy chain
    • MHC class I molecule
    • MHC HLA-B cell surface glycoprotein
    • MHC HLA-B transmembrane glycoprotein
    • SPDA1
    see all
  • Function

    Involved in the presentation of foreign antigens to the immune system.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Polyubiquitinated in a post ER compartment by interaction with human herpesvirus 8 MIR1 protein. This targets the protein for rapid degradation via the ubiquitin system.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225646 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225646 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA B.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS analysis result of ab225646 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA B.

References

ab225646 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up