Description

  • Product name

    Recombinant Human HLA-DOA protein
    See all HLA-DOA proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEFGDF ARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPKSRVEL
    • Amino acids

      28 to 125
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158654 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HLA class II histocompatibility antigen, DO alpha chain precursor
    • HLA D0 alpha
    • HLA DNA
    • HLA DZA
    • HLADZ
    • Lymphocyte antigen
    • Major histocompatibility complex, class II, DN alpha
    • Major histocompatibility complex, class II, DO alpha
    • MHC class II antigen DOA
    • MHC DN alpha
    • MHC DZ alpha
    see all
  • Relevance

    HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little sequence variation, especially at the protein level.
  • Cellular localization

    Cell Membrane; Single-pass type I membrane protein.

Images

  • ab158654 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158654 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158654.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up