Description

  • Product name

    Recombinant Human HLA G protein (His tag)
    See all HLA G proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAP WVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIG CDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAA NVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEAT LRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVP SGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTG AAVAAVLWRKKSSD
    • Predicted molecular weight

      40 kDa including tags
    • Amino acids

      25 to 338
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 338. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab225660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • B2 microglobulin
    • DADB-15K14.8
    • HLA 6.0
    • HLA class I histocompatibility antigen alpha chain G
    • HLA class I histocompatibility antigen, alpha chain G
    • HLA class I molecule
    • HLA G
    • HLA G antigen
    • HLA G histocompatibility antigen class I G
    • HLA G3
    • HLA-G
    • HLA-G histocompatibility antigen, class I
    • HLA60
    • HLAG
    • HLAG_HUMAN
    • Major histocompatibility complex class I G
    • MHC class I antigen
    • MHC class I antigen G
    • MHC G
    • T-cell A locus
    • TCA
    see all
  • Function

    Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T lymphocytes, macrophages and mononuclear cells.
  • Tissue specificity

    Expressed in trophoblasts.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab225660 with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of ab225660 could indicate that this peptide derived from Mammalian Cell-expressed human HLA-G.

  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of ab225660 could indicate that this peptide derived from Mammalian Cell-expressed human HLA-G.

References

ab225660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225660.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up