Description

  • Product name

    Recombinant Human HLA G protein (Tagged)
    See all HLA G proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAP WVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIG CDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAA NVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEAT LRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVP SGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTG AAVAAVLWRKKSSD
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      25 to 338
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 25 to 338 with a 6xHis-SUMO tag at the N-terminus. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab224851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • B2 microglobulin
    • DADB-15K14.8
    • HLA 6.0
    • HLA class I histocompatibility antigen alpha chain G
    • HLA class I histocompatibility antigen, alpha chain G
    • HLA class I molecule
    • HLA G
    • HLA G antigen
    • HLA G histocompatibility antigen class I G
    • HLA G3
    • HLA-G
    • HLA-G histocompatibility antigen, class I
    • HLA60
    • HLAG
    • HLAG_HUMAN
    • Major histocompatibility complex class I G
    • MHC class I antigen
    • MHC class I antigen G
    • MHC G
    • T-cell A locus
    • TCA
    see all
  • Function

    Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T lymphocytes, macrophages and mononuclear cells.
  • Tissue specificity

    Expressed in trophoblasts.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant Human HLA G protein (His tag) (ab224851) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis of ab224851 with 5% enrichment gel and 15% separation gel.

References

ab224851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up