Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFEKMSRPLPLNPTFIPPPYGVL RSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDK TLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPS VMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVP VGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDD LKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVA DLRKELGKCKNILAKYEARHGPLLEESGGGGSPGRRRRRRRRRRR
    • Molecular weight
      39 kDa including tags
    • Amino acids
      2 to 295
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      T7-His-TEV cleavage site Tag (31aa) fusion at its N-terminal and 11R tag at C-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185596 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab185596 was expressed in E. coli as inclusion bodies, refolded using our unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Additional notes

    1. May be used for in vitro HLF mediated HSC differentiation regulation study using either 11R mediated or “ProFectin” based intracellular delivery of this protein.

    2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.

    3. May be used for HLF protein-protein interaction mapping.

    4. As immunogen for specific antibody production.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.315% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • Hepatic leukemia factor
    • Hlf
    • HLF PAR bZIP transcription factor
    • HLF/E2A FUSION GENE
    • HLF_HUMAN
    • PAR bZIP transcription factor
    see all
  • Tissue specificity
    Highly expressed in liver; lower levels in lung and kidney.
  • Involvement in disease
    Note=A chromosomal aberration involving HLF is a cause of pre-B-cell acute lymphoblastic leukemia (B-ALL). Translocation t(17;19)(q22;p13.3) with TCF3.
  • Sequence similarities
    Belongs to the bZIP family. PAR subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab185596 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185596.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up