Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETL DRLDQEHSDKFGRRSSYGGSSYGNSTNNVPASSSTATASTQTQHSGMSPS PSNSYDTSPQPCTTNQNGRENNERLSTSNGKMSPTRYHANSMGQRSYSFE ASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQS RISHWLLQQGSDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEW RQTPPPVSATSGTFRLRRGSRFTWRKECLAVMESYFNENQYPDEAKREEI ANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES HGIDVQSPGGHSNSDDVDGNDYSEQDDSTSHSDHQDPISLAVEMAAVNHT ILALARQGANEIKTEALDDD
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 420

Specifications

Our Abpromise guarantee covers the use of ab132536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ21616
    • HMBOX1
    • HMBOX1A
    • HMBX1_HUMAN
    • HNF1LA
    • homeobox containing 1
    • Homeobox containing protein 1
    • Homeobox-containing protein 1
    • homeobox-containing protein PBHNF
    • PBHNF
    see all
  • Function

    Transcription factor. Isoform 1 acts as a transcriptional repressor. Isoform 4 has very low activity as a transcriptional repressor.
  • Tissue specificity

    Ubiquitous. Detected in pancreas, brain, spleen, placenta, prostate, thymus, liver, heart, bone marrow, skeletal muscle, stomach, uterus, testis, kidney, ovary, and colon.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus. Cytoplasm. Predominantly detected in cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab132536 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up