Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWK TMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGF FLFCSEFRPKIKSTNPGISIGDVAKKLGEMWNNLNDSEKQPYITKAAKLK EKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEEEEEDE
    • Amino acids
      1 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158663 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • chromosomal protein, Nonhistone, HMG4
    • High mobility group (nonhistone chromosomal) protein 4
    • High mobility group box 3
    • High mobility group protein 2a
    • High mobility group protein 4
    • High mobility group protein B3
    • High mobility group protein HMG4
    • HMG 4
    • HMG-2a
    • HMG-4
    • HMG2A
    • HMGB 3
    • Hmgb3
    • HMGB3_HUMAN
    • MGC90319
    • Non histone chromosomal protein
    • Nonhistone chromosomal protein HMG4
    see all
  • Function
    Binds preferentially single-stranded DNA and unwinds double stranded DNA.
  • Tissue specificity
    Expressed predominantly in placenta.
  • Sequence similarities
    Belongs to the HMGB family.
    Contains 2 HMG box DNA-binding domains.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • ab158663 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158663 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158663.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up