Description

  • Product name

    Recombinant Human HMGB2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab109962 was purified using conventional chromatography techniques.
  • Expression system

    Baculovirus
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
    • Predicted molecular weight

      26 kDa including tags
    • Amino acids

      1 to 209
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109962 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.058% Sodium chloride

General Info

  • Alternative names

    • C80539
    • High mobility group (nonhistone chromosomal) protein 2
    • High mobility group box 2
    • High mobility group protein 2
    • High mobility group protein B2
    • HMG 2
    • HMG B2
    • HMG-2
    • HMG2
    • HMGB2
    • HMGB2_HUMAN
    see all
  • Function

    DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).
  • Sequence similarities

    Belongs to the HMGB family.
    Contains 2 HMG box DNA-binding domains.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109962.

References

ab109962 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109962.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up