Description

  • Product name

    Recombinant Human HMGCR protein
    See all HMGCR proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYEC PKFEEDVLSSDIIILTITRCIAILYIYFQFQNLRQLGSKYILGIAGLFTI FSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTLAKFALSSNSQ DEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMS VLANYFVFMTFFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPN PVTQRVKMIMSLGLVLVHAHSRWIADPSPQNSTADTSKVSLGLDENVSKR IEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSL KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVI KPLVAETDTPNRATFVVGNSSLLDTSSVLVTQEPEIELPREPRPNEECLQ ILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHERGVSIRRQLLS KKLSEPSSLQYLPYRDYNYSLLGGGASSRVLADGMTRGPVVRLPRACDSA EVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGD AMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRG KSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHA ANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIG TVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSL MAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA
    • Predicted molecular weight

      118 kDa including tags
    • Amino acids

      1 to 835

Specifications

Our Abpromise guarantee covers the use of ab132810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3 hydroxy 3 methylglutaryl CoA reductase
    • 3 hydroxy 3 methylglutaryl Coenzyme A reductase
    • 3 hydroxymethylglutaryl CoA reductase
    • 3-hydroxy-3-methylglutaryl CoA reductase (NADPH)
    • 3-hydroxy-3-methylglutaryl-coenzyme A reductase
    • 3H3M
    • HMDH_HUMAN
    • HMG CoA reductase
    • HMG CoAR
    • HMG-CoA reductase
    • Hmgcr
    • Hydroxymethylglutaryl CoA reductase
    • LDLCQ3
    • MGC103269
    • Red
    see all
  • Function

    This transmembrane glycoprotein is involved in the control of cholesterol biosynthesis. It is the rate-limiting enzyme of sterol biosynthesis.
  • Pathway

    Metabolic intermediate biosynthesis; (R)-mevalonate biosynthesis; (R)-mevalonate from acetyl-CoA: step 3/3.
  • Sequence similarities

    Belongs to the HMG-CoA reductase family.
  • Cellular localization

    Endoplasmic reticulum membrane. Peroxisome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132810 stained with Coomassie Blue.

References

ab132810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up