Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKK EPGAKISRGAKGKKEEKQEAGKEGTEN
    • Amino acids
      1 to 77
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160428 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686E20226
    • FLJ42187
    • High mobility group nucleosomal binding domain 3
    • High mobility group nucleosome-binding domain-containing protein 3
    • HMGN3
    • HMGN3_HUMAN
    • OTTHUMP00000016772
    • OTTHUMP00000016773
    • PNAS 24
    • PNAS 25
    • PNAS24
    • PNAS25
    • Thyroid hormone receptor interacting protein 7
    • Thyroid receptor-interacting protein 7
    • TR-interacting protein 7
    • TRIP 7
    • TRIP-7
    • TRIP7
    see all
  • Function
    Binds to nucleosomes, regulating chromatin structure and consequently, chromatin-dependent processes such as transcription, DNA replication and DNA repair. Affects both insulin and glucagon levels and modulates the expression of pancreatic genes involved in insulin secretion. Regulates the expression of the glucose transporter SLC2A2 by binding specifically to its promoter region and recruiting PDX1 and additional transcription factors. Regulates the expression of SLC6A9, a glycine transporter which regulates the glycine concentration in synaptic junctions in the central nervous system, by binding to its transcription start site. May play a role in ocular development and astrocyte function.
  • Tissue specificity
    Expressed in kidney, lung, pancreas, testis, skeletal muscle, heart, thyroid gland, pituitary gland, prostate and uterus. Low expression in liver, spleen, placenta and ovaries.
  • Sequence similarities
    Belongs to the HMGN family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160428 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160428 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160428.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up