Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMASSMRSLFSDHGK YVESFRRFLNHSTEHQCMQEFMDKKLPGIIGRIGDTKSEIKILSIGGGAG EIDLQILSKVQAQYPGVCINNEVVEPSAEQIAKYKELVAKTSNLENVKFA WHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGT NAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYITSDDLTQMLDNLGLK YECYDLLSTMDISDCFIDGDENGDLLWDFLTETCNFNATAPPDLRAELGK DLQEPEFSAKKEGKVLFNNTLSFIVIEA
    • Molecular weight

      37 kDa including tags
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_008826.

Specifications

Our Abpromise guarantee covers the use of ab229173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific activity is > 200 nmol/min/mg, and is defined as the amount of enzyme that transfers 1.0 nmole of methyl group per minute at 37°C.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab229173 was purified using conventional chromatography.
  • Form

    Liquid
  • Additional notes

    Previously labelled as HNMT. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EC 2.1.1.8
    • Histamine N methyltransferase
    • Histamine N-methyltransferase
    • HMT
    • HNMT
    • HNMT S1
    • HNMT S2
    • HNMT_HUMAN
    see all
  • Function

    Inactivates histamine by N-methylation. Plays an important role in degrading histamine and in regulating the airway response to histamine.
  • Sequence similarities

    Belongs to the methyltransferase superfamily. HNMT family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229173.

References

ab229173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up