Description

  • Product name

    Recombinant Human HNF4 gamma protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPM STLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      310 to 407

Specifications

Our Abpromise guarantee covers the use of ab116986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Hepatocyte nuclear factor 4 gamma
    • Hepatocyte nuclear factor 4-gamma
    • HNF 4 gamma
    • HNF-4-gamma
    • Hnf4g
    • HNF4G_HUMAN
    • NR2A2
    • NR2A3
    • Nuclear receptor subfamily 2 group A member 2
    see all
  • Function

    Transcription factor. Has a lower transcription activation potential than HNF4-alpha.
  • Tissue specificity

    Expressed in pancreas, kidney, small intestine and testis. Weakly expressed in colon. Not expressed in liver, skeletal muscle, lung, placenta, brain, heart, peripheral blood, ovary, prostate, thymus and spleen.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR2 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116986 at approximately 36.41 kDa.
    Stained with Coomassie Blue.

References

ab116986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up