Description

  • Product name

    Recombinant Human hnRNP A1 (isoform A1-A) protein
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN TKR SRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRP GAHLTVKK IFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKR GFAFVTFDDHDSV DKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQR GRSGSGNFGGGRGGGFGG NDNFGRGGNFSGRGGFGGSRGGGGYGGSGD GYNGFGNDGSNFGGGGSYNDFGN YNNQSSNFGPMKGGNFGGRSSGPYG GGGQYFAKPRNQGGYGGSSSSSSYGSGR RF (Amino acid sequence (Sequence determined by 5' Sequencing))

Specifications

Our Abpromise guarantee covers the use of ab91691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Western blot

  • Form

    Lyophilised
  • Additional notes

    Protein Identity confirmed by Mass Spectrometry (MS/MS)(acquired on initial reference batch)
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 4.50
    Constituents: 1.2% Monobasic dihydrogen sodium phosphate, 0.5% Trehalose, 36% Urea, 1.64% Sodium phosphate, 0.058% Sodium chloride

  • Reconstitution
    Reconstitute with 50 µl distilled water.

General Info

  • Alternative names

    • Helix-destabilizing protein
    • Heterogeneous nuclear ribonucleoprotein A1
    • HN RPA1L3
    • hnRNP A1
    • hnRNP core protein A1
    • HNRNPA1
    • M MGC102835
    • ROA1_HUMAN
    • Single-strand RNA-binding protein
    see all
  • Function

    Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication.
  • Sequence similarities

    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Arg-194, Arg-206 and Arg-225 are dimethylated, probably to asymmetric dimethylarginine.
    Sumoylated.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes. In the course of viral infection, colocalizes with HCV NS5B at speckles in the cytoplasm in a HCV-replication dependent manner.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thanks you for your enquiry. No enzymatic activity was tested for ab91691 yet. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up