Overview

  • Product name

    Recombinant Human hnRNP K protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQ SKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEI LKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLL IHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPD RVVECIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRP VGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRG GSRARNLPLPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAID TWSPSEWQMAYEPQGGSGYDYSYAGGRGSYGDLGGPIITTQVTIPKDLAG SIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYL LQNSVKQYSGKFF
    • Molecular weight

      77 kDa including tags
    • Amino acids

      1 to 463

Specifications

Our Abpromise guarantee covers the use of ab132460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CSBP
    • dC stretch binding protein
    • FLJ41122
    • Heterogeneous nuclear ribonucleoprotein K
    • hnRNP K
    • HNRNPK
    • HNRPK
    • HNRPK_HUMAN
    • Transformation up regulated nuclear protein
    • Transformation up-regulated nuclear protein
    • Transformation upregulated nuclear protein
    • TUNP
    see all
  • Function

    One of the major pre-mRNA-binding proteins. Binds tenaciously to poly(C) sequences. Likely to play a role in the nuclear metabolism of hnRNAs, particularly for pre-mRNAs that contain cytidine-rich sequences. Can also bind poly(C) single-stranded DNA.
  • Sequence similarities

    Contains 3 KH domains.
  • Post-translational
    modifications

    Arg-296 and Arg-299 are dimethylated, probably to asymmetric dimethylarginine.
  • Cellular localization

    Cytoplasm. Nucleus > nucleoplasm. In case of ASFV infection, there is a shift in the localization which becomes predominantly nuclear.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132460 on a 12.5% gel stained with Coomassie Blue.

References

This product has been referenced in:

  • Malik N  et al. The transcription factor CBFB suppresses breast cancer through orchestrating translation and transcription. Nat Commun 10:2071 (2019). Read more (PubMed: 31061501) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up