Overview

  • Product name

    Recombinant Human HNRPDL protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GKCEIKVAQPKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGF NNYYDQGYGNYNSAYGGDQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQ STYGKASRG
    • Amino acids

      301 to 409
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A+U-rich element RNA binding factor
    • AA407431
    • AA959857
    • AU rich element RNA binding factor
    • AU-rich element RNA-binding factor
    • D5Ertd650e
    • D5Wsu145e
    • Heterogeneous nuclear ribonucleoprotein D like
    • Heterogeneous nuclear ribonucleoprotein D like protein
    • Heterogeneous nuclear ribonucleoprotein D-like
    • hnHNRP DL
    • HNRDL_HUMAN
    • HNRNP
    • hnRNP D-like
    • hnRNP DL
    • HNRNPDL
    • hnRPD like protein
    • JKT41 binding protein
    • JKT41-binding protein
    • JKTBP
    • JKTBP2
    • laAUF1
    • MGC125262
    • Protein laAUF1
    see all
  • Function

    Acts as a transcriptional regulator. Promotes transcription repression. Promotes transcription activation in differentiated myotubes (By similarity). Binds to double- and single-stranded DNA sequences. Binds to the transcription suppressor CATR sequence of the COX5B promoter (By similarity). Binds with high affinity to RNA molecules that contain AU-rich elements (AREs) found within the 3'-UTR of many proto-oncogenes and cytokine mRNAs. Binds both to nuclear and cytoplasmic poly(A) mRNAs. Binds to poly(G) and poly(A), but not to poly(U) or poly(C) RNA homopolymers. Binds to the 5'-ACUAGC-3' RNA consensus sequence.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocytes. Expressed in myeloid leukemia, gastric adenocarcinoma, cervical carcinoma, hepatoma, fibrosarcoma, colon adenocarcinoma, epidermoid carcinoma, osteosarcoma and urinary bladder carcinoma cells.
  • Sequence similarities

    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Dimethylation of Arg-408 is probably of the asymmetric type.
  • Cellular localization

    Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm in a TNPO1-dependent manner.
  • Information by UniProt

Images

  • ab160746 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160746 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160746.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up