Description

  • Product name

    Recombinant Human HNT protein (Tagged-His Tag)
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab192280 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWC LDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQ VSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSED EYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGV PVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFF NVSEHDYGNYTCVASNKLGHTNASIMLFGETVLVDHHHHHH
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      34 to 316
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 34 to 316 of isoform 3. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab192280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    0.2 µM filtered solution

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml

General Info

  • Alternative names

    • hNT
    • IgLON family member 2
    • IGLON2
    • Neurotrimin
    • NT
    • NTM
    • NTRI_HUMAN
    see all
  • Function

    Neural cell adhesion molecule.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. IgLON family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab192280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up