Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEETQPPPQPKLPLCDSLMIWLQTFNTASPCQDVKQLTSGVAMAQVLHQI DAAWFNESWLSRIKEDVGDNWRIKASNVKKVLQGIMSYYHEFLGQQISEA LIPDLNQITECSDPVELGRLLQLILGCAINCEKKQEHIQNIMTLEESVQH VVMTAIQELMSKEILSSPPNDAVGELEQQLKRALEELQEALAEKEELRQR CEELDMQVTTLQDEKNSLVSENEMMNEKLDQLDGSFDDPNTVVAKKYFHA QLQLEQLQEENFRLEAAKDDYRVHCEELEKQLIEFQHRNDELTSLAEETR ALKDEIDVLRATSDKANKLESTVEIYRQKLQDLNDLRKQVKTLQETNMMY MHNTVSLEEELKKANAARTQLETYKRQVQDLHVKLSSESKRADTLAFEMK RLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKS YENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQEQLEQKH RKMNELETEQRLSKERIRELQQQIEDLQKSLQEQGSKSEGESSSKLKQKL EAHMEKLTEVHEELQKKQELIEDLQPDINQNVQKINELEAALQKKDEDMK AMEERYKMYLEKARNVIKTLDPKLNPASAEIMLLRKQLAEKERRIEILES ECKVAKFRDYEEKLIVSAWYNKSLAFQKLGMESRLVSGGGACSDTGACTP ARSFLAQQRHITNTRRNLSVKVPATTSD
    • Molecular weight

      111 kDa including tags
    • Amino acids

      1 to 728

Specifications

Our Abpromise guarantee covers the use of ab132778 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A930033L17Rik
    • Abnormal spermatozoon head shape
    • azh
    • h-hook1
    • hHK1
    • HK1
    • HOOK 1
    • Hook homolog 1 (Drosophila)
    • Hook1
    • HOOK1_HUMAN
    • MGC10642
    • OTTHUMP00000010548
    • OTTMUSP00000008480
    • Protein Hook homolog 1
    • RP23-80B16.4
    see all
  • Function

    Required for spermatid differentiation. Probably involved in the positioning of the microtubules of the manchette and the flagellum in relation to the membrane skeleton (By similarity). Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex).
  • Sequence similarities

    Belongs to the hook family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cytoplasm. Localizes to the spermatid manchette during spermiogenesis but is not present in mature spermatozoa (By similarity). Localizes to punctate cytoplasmic foci which do not appear to overlap with early or late endosomes, the endoplasmic reticulum, the Golgi complex, multivesicular bodies (MVBs), lysosomes, or mitochondria. Often found in close association with microtubules.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132778, stained with Coomassie Blue.

References

ab132778 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132778.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up