Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPD FSPCSFQSKATVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAA AAPDGRYMRSWLEPTPGALSFAGLPSSRPYGIKPEPLSARRGDCPTLDTH TLSLTDYACGSPPVDREKQPSEGAFSENNAENESGGDKPPIDPNNPAANW LHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQV KIWFQNRRMKMKKINKDRAKDE
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 272

Specifications

Our Abpromise guarantee covers the use of ab152453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ABD-B
    • Abd-B, drosophila, homolog of
    • D6a9
    • Homeobox 1G
    • Homeobox A9
    • Homeobox protein Hox-1.7
    • Homeobox protein Hox-1G
    • Homeobox protein Hox-A9
    • Homeodomain protein HOXA9
    • Hox-1.7
    • Hox-1.7, mouse, homolog of
    • HOX1
    • Hox1.7
    • Hox1G
    • Hox1r5
    • Hoxa-9
    • Hoxa7
    • HOXA9
    • HOXA9/MSI2 fusion gene, included
    • HOXA9/NUP98 fusion gene, included
    • HXA9_HUMAN
    • MGC1934
    see all
  • Function

    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Involvement in disease

    Note=A chromosomal aberration involving HOXA9 is found in a form of acute myeloid leukemia. Translocation t(7;11)(p15;p15) with NUP98.
    Note=A chromosomal aberration involving HOXA9 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with MSI2.
  • Sequence similarities

    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE gel showing ab152453 stained with Coomassie Blue

References

This product has been referenced in:

  • Zhou L  et al. HOXA9 inhibits HIF-1a-mediated glycolysis through interacting with CRIP2 to repress cutaneous squamous cell carcinoma development. Nat Commun 9:1480 (2018). Read more (PubMed: 29662084) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up