Overview

  • Product name
    Recombinant Human HOXB9 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSC SFQPKAPVFGASWAPLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTW
    • Amino acids
      1 to 98
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeo box 2E
    • Homeo box B9
    • Homeobox B9
    • Homeobox protein Hox B9
    • Homeobox protein Hox-2.5
    • Homeobox protein Hox-2E
    • Homeobox protein Hox-B9
    • Hox 2.5
    • Hox 2E
    • HOX2
    • HOX2E
    • Hoxb9
    • HXB9_HUMAN
    • OTTHUMP00000216946
    • OTTHUMP00000243325
    see all
  • Function
    Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
  • Sequence similarities
    Belongs to the Abd-B homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Expressed in whole embryos and fetuses at 5-9 weeks from conception.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158681 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up