Recombinant Human HOXD13 protein (ab158691)

Overview

  • Product name
    Recombinant Human HOXD13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRAGSWDMDGLRADGGGAGGAPASSSSSSVAAAAASGQCRGFLSAPVFA GTHSGRAAAAAAAAAAAAAAASGFAYPGTSERTGSSSSSSSSAVVAARPE APPAKECPAPTPAAAAAAPPSAPALGYGYHFGNGYYSCRMSHGVGLQQNA LKSSPHASLGGFPVEKYMDVSGLASSSVPANEVPARAKEVSFYQGYTSPY QHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNSQVYCTKDQPQ GSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKF INKDKRRRISAATNLSERQVTIWFQNRRVKDKKIVSKLKDTVS
    • Amino acids
      1 to 343
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HOXD13
    • BDE
    • BDSD
    • Homeo box 4I
    • Homeo box D13
    • Homeo box protein Hox D13
    • Homeo box protein HoxD13
    • Homeobox 4I
    • Homeobox D13
    • homeobox protein Hox 4I
    • Homeobox protein Hox D13
    • Homeobox protein Hox-D13
    • Homeobox protein HoxD13
    • Homeobox4I
    • HomeoboxD13
    • Hox 4I
    • HOX D13
    • Hox-4.8
    • Hox4I
    • HOXD 13
    • HoxD13
    • SPD
    see all
  • Relevance
    This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. Mutations in this particular gene cause synpolydactyly.
  • Cellular localization
    Nuclear

Images

  • ab158691 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up