Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTTYSDKGAKPERGRFLHFHSVTFWVGNAK QAASFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNK EMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGK VKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEM IDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIVVA NYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRH LRERGLEFLSVPSTYYKQLREKLKTAKIKVKENIDALEELKILVDYDEKG YLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQNLRGN LTNMETNGVVPGM
    • Molecular weight
      47 kDa including tags
    • Amino acids
      2 to 393
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.29% Sodium chloride, 0.02% DTT, 0.002% PMSF, 0.32% Tris HCl

General Info

  • Alternative names
    • 4 HPPD
    • 4 hydroxyphenylpyruvate dioxygenase
    • 4 hydroxyphenylpyruvic acid oxidase
    • 4-hydroxyphenylpyruvate dioxygenase
    • 4-hydroxyphenylpyruvic acid oxidase
    • 4HPPD
    • GLOD3
    • glyoxalase domain containing 3
    • HPD
    • HPPD_HUMAN
    • HPPDase
    • PPD
    see all
  • Function
    Key enzyme in the degradation of tyrosine.
  • Pathway
    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 3/6.
  • Involvement in disease
    Tyrosinemia 3
    Hawkinsinuria
  • Sequence similarities
    Belongs to the 4HPPD family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172151 in 1) Non reducing or 2) Reducing conditions.

References

ab172151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up