Description

  • Product name

    Recombinant human HPRT protein (Active)
    See all HPRT proteins and peptides
  • Biological activity

    Specific activity is > 15 units/mg and is defined as the amount of enzyme that catalyze the formation of 1 µmole of guanosine 5’-monophosphate (GMP) per minute from guanine and phosphoribosyl pyrophosphate at pH 7.5 at 37°C.

  • Purity

    > 95 % SDS-PAGE.
    ab222951 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAE DLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKGGYKFFADLLD YIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNV LIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 218
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000185.

Specifications

Our Abpromise guarantee covers the use of ab222951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.32% Tris HCl

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • HGPRT
    • HGPRTase
    • HPRT 1
    • HPRT_HUMAN
    • HPRT1
    • Hypoxanthine guanine phosphoribosyltransferase
    • Hypoxanthine phosphoribosyltransferase 1
    • Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome)
    • Hypoxanthine-guanine phosphoribosyltransferase
    see all
  • Function

    Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
  • Pathway

    Purine metabolism; IMP biosynthesis via salvage pathway; IMP from hypoxanthine: step 1/1.
  • Involvement in disease

    Defects in HPRT1 are the cause of Lesch-Nyhan syndrome (LNS) [MIM:300322]. LNS is characterized by complete lack of enzymatic activity that results in hyperuricemia, choreoathetosis, mental retardation, and compulsive self-mutilation.
    Defects in HPRT1 are the cause of gout HPRT-related (GOUT-HPRT) [MIM:300323]; also known as HPRT-related gout or Kelley-Seegmiller syndrome. Gout is characterized by partial enzyme activity and hyperuricemia.
  • Sequence similarities

    Belongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab222951.

References

ab222951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up