Overview

  • Product name

    Recombinant human HRG protein (Active)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    CHO cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      VSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYY LVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQD LRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEE NDDFASFRVDRIERVARVRGGEGTGYFVDFSVRNCPRHHFPRHPNVFGFC RADLFYDVEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGH ERSSTTKPPFKPHGSRDHHHPHKPHEHGPPPPPDERDHSHGPPLPQGPPP LLPMSCSSCQHATFGTNGAQRHSHNNNSSDLHPHKHHSHEQHPHGHHPHA HHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCD PPPHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGE VLPLPEANFPSFPLPHHKHPLKPDNQPFPQSVSESCPGKFKSGFPQVSMF FTHTFPK
    • Molecular weight

      58 kDa
    • Amino acids

      19 to 525
    • Additional sequence information

      Full-length mature chain. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab224781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by its ability to support adhesion of Con-A activated MOLT-4 cells to the Recombinant Human HPRG-coated surface. The ED50 for this effect is 1.5-2.0 μg/ml.

  • Applications

    HPLC

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    Purity is greater than 90% by SDS-PAGE gel and HPLC analyses.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • DKFZp779H1622
    • Histidine proline rich glycoprotein
    • Histidine rich glycoprotein
    • HPRG
    • HRGP
    • Thrombophilia due to elevated HRG
    see all
  • Relevance

    HRG (histidine-rich glycoprotein) contains two cystatin-like domains and is located in plasma and platelets. The physiological function is not yet known. It binds heme, dyes and divalent metal ions. It can inhibit rosette formation and interacts with heparin, thrombospondin, and the lysine-binding site of plasminogen. A potential prothrombotic effect of HRG is indicated by the inhibition of fibrinolysis and the reduction of inhibition of coagulation. Mutations in HRG lead to thrombophilia due to abnormal histidine-rich glycoprotein levels.
  • Cellular localization

    Secreted

References

ab224781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up