Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQW AVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSV KIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEI QSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSA SKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADE FVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV AYLKLNTKVR
    • Amino acids

      1 to 310
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 17 @beta HSD III
    • 17 beta HSD 3
    • 17-@beta hydroxysteroid dehydrogenase III
    • 17-beta-HSD 3
    • 17-beta-hydroxysteroid dehydrogenase type 3
    • DHB3_HUMAN
    • EC 1.1.1.64
    • EDH17B3
    • Estradiol 17 beta dehydrogenase
    • Estradiol 17 beta dehydrogenase 3
    • HSD17B3
    • Hydroxysteroid (17 beta) dehydrogenase 3
    • OTTHUMP00000021718
    • SDR12C2
    • Short chain dehydrogenase/reductase family 12C member 2
    • Testicular 17 @beta hydroxysteroid dehydrogenase III
    • Testicular 17 beta hydroxysteroid dehydrogenase
    • Testicular 17-beta-hydroxysteroid dehydrogenase
    • Testosterone 17 beta dehydrogenase 3
    • Testosterone 17-beta-dehydrogenase 3
    see all
  • Function

    Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH.
  • Tissue specificity

    Testis.
  • Pathway

    Hormone biosynthesis; testosterone biosynthesis.
  • Involvement in disease

    Defects in HSD17B3 are the cause of male pseudohermaphrodism with gynecomastia (MPH) [MIM:264300]. These individuals have unambiguous female external genitalia at birth, but fail to menstruate at the time of expected puberty and instead virilize as evidenced by growth of the phallus. Breast development may or may not take place.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Information by UniProt

Images

  • ab158703 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up