Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLI SRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEK
    • Amino acids
      29 to 119
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158704 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 17 @beta HSD III
    • 17 beta HSD 3
    • 17-@beta hydroxysteroid dehydrogenase III
    • 17-beta-HSD 3
    • 17-beta-hydroxysteroid dehydrogenase type 3
    • DHB3_HUMAN
    • EC 1.1.1.64
    • EDH17B3
    • Estradiol 17 beta dehydrogenase
    • Estradiol 17 beta dehydrogenase 3
    • HSD17B3
    • Hydroxysteroid (17 beta) dehydrogenase 3
    • OTTHUMP00000021718
    • SDR12C2
    • Short chain dehydrogenase/reductase family 12C member 2
    • Testicular 17 @beta hydroxysteroid dehydrogenase III
    • Testicular 17 beta hydroxysteroid dehydrogenase
    • Testicular 17-beta-hydroxysteroid dehydrogenase
    • Testosterone 17 beta dehydrogenase 3
    • Testosterone 17-beta-dehydrogenase 3
    see all
  • Function
    Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH.
  • Tissue specificity
    Testis.
  • Pathway
    Hormone biosynthesis; testosterone biosynthesis.
  • Involvement in disease
    Defects in HSD17B3 are the cause of male pseudohermaphrodism with gynecomastia (MPH) [MIM:264300]. These individuals have unambiguous female external genitalia at birth, but fail to menstruate at the time of expected puberty and instead virilize as evidenced by growth of the phallus. Breast development may or may not take place.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Information by UniProt

Images

  • ab158704 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158704 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158704.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up