Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRKVVLITGASSGIGLALCKRLLAEDDELHLCLACRNMSKAEAVCAALLA SHPTAEVTIVQVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLN IKALFFGLFSRKVIHMFSTAEGLLTQGDKITADGLQEVFETNVFGHFILI RELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYAT DLLSVALNRNFNQQGLYSNVACPGTALTNLTYGILPPFIWTLLMPAILLL RFFANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQ KMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
    • Molecular weight

      65 kDa including tags
    • Amino acids

      1 to 341

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 17 beta HSD 7
    • 17 beta hydroxysteroid dehydrogenase 7
    • 17 beta hydroxysteroid dehydrogenase type VII
    • 17-beta-HSD 7
    • 17-beta-hydroxysteroid dehydrogenase 7
    • 17beta hydroxysteroid dehydrogenase
    • 3 keto steroid reductase
    • 3-keto-steroid reductase
    • DHB7_HUMAN
    • Estradiol 17 beta dehydrogenase 7
    • Estradiol 17-beta-dehydrogenase 7
    • Hsd17b7
    • Hydroxysteroid (17 beta) dehydrogenase 7
    • MGC12523
    • MGC75018
    • PRAP
    • SDR37C1
    • Short chain dehydrogenase/reductase family 37C member 1
    see all
  • Function

    Responsible for the reduction of the keto group on the C-3 of sterols.
  • Tissue specificity

    Highly expressed in adrenal gland, liver, lung and thymus. Expressed in breast, ovaries, pituitary gland, pregnant uterus, prostate, kidney, lymph node, small intestine, spinal cord and trachea. Weakly expressed in all other tissues tested. Isoform 3 is expressed in eye ciliary epithelial cells and neuroendocrine cells.
  • Pathway

    Steroid biosynthesis; estrogen biosynthesis.
    Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 5/6.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family. ERG27 subfamily.
  • Post-translational
    modifications

    Phosphorylated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132794 stained with Coomassie Blue.

References

ab132794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up