Description

  • Product name

    Recombinant Human HSF1 protein
    See all HSF1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Constructed with C-terminal 11 arginine tag, which efficiently delivers the protein intracellularly. ab204184 was expressed in E.coli as inclusion bodies, refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFDLPVGPGAAGPSNVPAFLTKL WTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQ LNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSV STLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREV ASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSM PKYSRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELA PASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVD TLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEK CLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSV TVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQP LFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPK AKDPTVSLEESGGGGSPGRRRRRRRRRRR
    • Predicted molecular weight

      57 kDa
    • Amino acids

      2 to 529
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Expressed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal and a Polyarginine tag at the C-terminal (NP_005517).

Specifications

Our Abpromise guarantee covers the use of ab204184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • Heat shock factor 1
    • Heat shock factor protein 1
    • Heat shock transcription factor 1
    • HSF 1
    • hsf1
    • HSF1_HUMAN
    • HSTF 1
    • HSTF1
    see all
  • Function

    DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. In higher eukaryotes, HSF is unable to bind to the HSE unless the cells are heat shocked.
  • Sequence similarities

    Belongs to the HSF family.
  • Domain

    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications

    Phosphorylated on multiple serine residues, a subset of which are involved in stress-related regulation of transcription activation. Constitutive phosphorylation represses transcriptional activity at normal temperatures. Levels increase on specific residues heat-shock and enhance HSF1 transactivation activity. Phosphorylation on Ser-307 derepresses activation on heat-stress and in combination with Ser-303 phosphorylation appears to be involved in recovery after heat-stress. Phosphorylated on Ser-230 by CAMK2, in vitro. Cadmium also enhances phosphorylation at this site. Phosphorylation on Ser-303 is a prerequisite for HSF1 sumoylation. Phosphorylation on Ser-121 inhibits transactivation and promotes HSP90 binding. Phosphorylation on Thr-142 also mediates transcriptional activity induced by heat. Phosphorylation on Ser-326 plays an important role in heat activation of HSF1 transcriptional activity.
    Sumoylated with SUMO1 and SUMO2 on heat-shock. Heat-inducible sumoylation occurs after 15 min of heat-shock, after which levels decrease and at 4 hours, levels return to control levels. Sumoylation has no effect on HSE binding nor on transcriptional activity. Phosphorylation on Ser-303 is a prerequisite for sumoylation.
  • Cellular localization

    Cytoplasm. Nucleus. Cytoplasmic during normal growth. On activation, translocates to nuclear stress granules. Colocalizes with SUMO1 in nuclear stress granules.
  • Information by UniProt

References

ab204184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up