Description

  • Product name

    Recombinant Human Hsp40 protein
    See all Hsp40 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab172855 is 0.2 µM filtered.
  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAE AYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHA MFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSR SAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNE DKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRD GSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGE GLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPILEHHHHHH
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      1 to 340
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.03% EDTA, 99% PBS

General Info

  • Alternative names

    • DnaJ (Hsp40) homolog subfmaily B member 1
    • DNAJ 1
    • DNAJ B1
    • DnaJ heat shock protein family (Hsp40) member B1
    • DnaJ homolog subfamily B member 1
    • DnaJ protein homolog 1
    • DNAJ1
    • DNAJB 1
    • Dnajb1
    • DNAJB1 protein
    • DNJB1_HUMAN
    • HDJ 1
    • HDJ-1
    • HDJ1
    • Heat shock 40 kDa protein 1
    • Heat shock 40kD protein 1
    • Heat shock protein 40
    • Hsp 40
    • HSP40
    • HSPF 1
    • HSPF1
    • Human DnaJ protein 1
    • Radial spoke 16 homolog B
    • RSPH16B
    • Sis1
    see all
  • Function

    Interacts with HSP70 and can stimulate its ATPase activity. Stimulates the association between HSC70 and HIP.
  • Sequence similarities

    Contains 1 J domain.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus. Translocates rapidly from the cytoplasm to the nucleus, and especially to the nucleoli, upon heat shock.
  • Information by UniProt

References

ab172855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up