Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL IGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDK PKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYF NDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDL GGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHK KDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLL QDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLS LGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNAPGVLIQVYEGERAMT KDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANK ITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMK SAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVDHHHHHH
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 641
    • Modifications

      mutated Q435 A
    • Tags

      His tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_005345

Specifications

Our Abpromise guarantee covers the use of ab198125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.19% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.04% Tween

General Info

  • Alternative names

    • DnaK type molecular chaperone HSP70 1
    • Epididymis secretory protein Li 103
    • FLJ54303
    • FLJ54370
    • FLJ54392
    • FLJ54408
    • FLJ75127
    • Heat shock 70 kDa protein 1
    • Heat shock 70 kDa protein 1/2
    • Heat shock 70 kDa protein 1A
    • Heat shock 70 kDa protein 1A/1B
    • Heat shock 70kDa protein 1B
    • Heat shock induced protein
    • HEL S 103
    • HSP70 1
    • HSP70 1A
    • HSP70 1B
    • HSP70 2
    • HSP70-1
    • HSP70-1/HSP70-2
    • HSP70-1A
    • HSP70-2
    • HSP70.1
    • HSP70.1/HSP70.2
    • HSP71_HUMAN
    • HSP72
    • HSPA1
    • HSPA1A
    • HSPA1B
    see all
  • Relevance

    Function: In cooperation with other chaperones, the Hsp70 family stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell. Tissue specificity: HSPA1B is testis-specific.
  • Cellular localization

    Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.

Images

  • 4-20% SDS-PAGE analysis of ab198125 with Coomassie staining.

References

ab198125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up