Description

  • Product name

    Recombinant human Hsp90 alpha protein (Carboxyterminal end)
    See all Hsp90 alpha proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHGGGLNDIFEAQKIEWHEEFEGKTLVSVTKEGLELPEDEEEKKK QEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANM ERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSA AVTEEMPPLEGDDDTSRMEEVD
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      535 to 732
    • Tags

      His tag N-Terminus , proprietary tag N-Terminus
    • Additional sequence information

      NM_005348. Expressed in an E. coli expression system and enzymatically Biotin-labeled using Avi-tag ™ technology.

Specifications

Our Abpromise guarantee covers the use of ab196407 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.64% Tris HCl, 0.64% Sodium chloride, 0.017% Potassium chloride, 0.04% Tween, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EL52
    • epididymis luminal secretory protein 52
    • Heat shock 86 kDa
    • heat shock 90kD protein 1, alpha
    • Heat shock 90kD protein 1, alpha like 4
    • heat shock 90kD protein, alpha-like 4
    • Heat shock 90kDa protein 1 alpha
    • Heat shock protein 90kDa alpha (cytosolic) class A member 1
    • Heat shock protein HSP 90-alpha
    • HS90A_HUMAN
    • HSP 86
    • HSP86
    • Hsp89
    • HSP89A
    • Hsp90
    • HSP90A
    • HSP90AA1
    • HSP90ALPHA
    • HSP90N
    • HSPC1
    • HSPCA
    • HSPCAL1
    • HSPCAL4
    • HSPN
    • LAP 2
    • LAP2
    • lipopolysaccharide-associated protein 2
    • LPS-associated protein 2
    • Renal carcinoma antigen NY-REN-38
    see all
  • Function

    Molecular chaperone. Has ATPase activity.
  • Sequence similarities

    Belongs to the heat shock protein 90 family.
  • Post-translational
    modifications

    ISGylated.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • Hsp90 alpha protein (Carboxyterminal end):PPID binding activity measured using Hsp90 alpha protein (Carboxyterminal end) a Inhibitor Screening Assay Kit,

  • 4-20% SDS-PAGE analysis of ab196407 at 2 µg stained with Coomassie Blue.

  • All lanes : Streptavidin-HRP Western blot

    Lane 1 : ab196407
    Lane 2 : Biotinylated control

    Lysates/proteins at 0.25 µg per lane.

References

ab196407 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196407.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up