Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA LDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLIN NLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHN DDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKE VVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKI EDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKI LKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRR LSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFV ERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEK KKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKA VKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP NAAVPDEIPPLEGDEDASRMEEVD
    • Molecular weight

      110 kDa including tags
    • Amino acids

      1 to 724

Specifications

Our Abpromise guarantee covers the use of ab131923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 90 kda heat shock protein beta HSP90 beta
    • D6S182
    • FLJ26984
    • Heat shock 84 kDa
    • Heat shock 90kD protein 1, beta
    • Heat shock 90kDa protein 1 beta
    • Heat shock protein 90 alpha family class B member 1
    • Heat shock protein 90 kDa
    • Heat shock protein 90kDa alpha (cytosolic) class B member 1
    • Heat shock protein 90kDa alpha family class B member 1
    • Heat shock protein beta
    • Heat shock protein HSP 90 beta
    • Heat shock protein HSP 90-beta
    • HS90B_HUMAN
    • HSP 84
    • HSP 90
    • HSP 90 b
    • HSP 90b
    • HSP84
    • HSP90 BETA
    • hsp90ab1
    • HSP90B
    • HSPC2
    • HSPCB
    see all
  • Function

    Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
  • Sequence similarities

    Belongs to the heat shock protein 90 family.
  • Domain

    The TPR repeat-binding motif mediates interaction with TPR repeat-containing proteins.
  • Post-translational
    modifications

    Ubiquitinated in the presence of STUB1-UBE2D1 complex (in vitro).
    ISGylated.
    S-nitrosylated; negatively regulates the ATPase activity.
  • Cellular localization

    Cytoplasm. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131923 stained with Coomassie Blue.

References

ab131923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up