Overview

  • Product name
    Recombinant Human HSPA4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGA AAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTG IKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID
    • Amino acids
      1 to 148
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • APG 2
    • Epididymis secretory sperm binding protein Li 5a
    • Heat shock 70 kDa protein 4
    • Heat shock 70 related protein APG 2
    • Heat shock 70-related protein APG-2
    • Heat shock protein, 110 kDa
    • HEL S 5a
    • HS24/P52
    • hsp70
    • Hsp70 RY
    • hsp70RY
    • HSP74_HUMAN
    • HSPA4
    • HSPH2
    • MGC131852
    • RY
    see all
  • Sequence similarities
    Belongs to the heat shock protein 70 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158708 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up