Description

  • Product name

    Recombinant Human HSPC150/UBE2T protein
    See all HSPC150/UBE2T proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGV FKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRP SLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKH ARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
    • Predicted molecular weight

      23 kDa
    • Amino acids

      1 to 197
    • Additional sequence information

      NM_014176.

Specifications

Our Abpromise guarantee covers the use of ab206015 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as HSPC150

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 10% Glycerol, 0.02% Beta mercaptoethanol, 0.87% Sodium chloride, 0.24% Tris

General Info

  • Alternative names

    • Cell proliferation inducing gene 50 protein
    • Cell proliferation-inducing gene 50 protein
    • HSPC150
    • HSPC150 protein similar to ubiquitin conjugating enzyme
    • PIG50
    • Ube2t
    • UBE2T_HUMAN
    • Ubiquitin carrier protein T
    • Ubiquitin conjugating enzyme
    • ubiquitin conjugating enzyme E2 T
    • Ubiquitin conjugating enzyme E2T
    • Ubiquitin protein ligase T
    • Ubiquitin-conjugating enzyme E2 T
    • Ubiquitin-protein ligase T
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to catalyze polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of  ab206015 (5 µg).

References

ab206015 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206015.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up