Description

  • Product name

    Recombinant Human HSPC152 protein (Tagged)
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVE WSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQC PESGRMFPISRGIPNMLLSEEETES
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 125
    • Additional sequence information

      N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab239546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • HSPC152
    • HSPC170
    • HSPC170 protein
    • Hypothetical protein HSPC152
    • Hypothetical protein LOC51504
    • TR112_HUMAN
    • TRM112
    • TRM112 like protein
    • TRM112-like protein
    • TRMT11 2
    • Trmt112
    • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
    • tRNA methyltransferase 112 homolog
    see all
  • Function

    Participates both in methylation of protein and tRNA species. The heterodimer with HEMK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.
  • Sequence similarities

    Belongs to the TRM112 family.
    Contains 1 TRM112 domain.
  • Information by UniProt

Images

  • ab239546 analysis by (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239546 could indicate that this peptide derived from E.coli-expressed Human HSPC152.

  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of ab239546 could indicate that this peptide derived from E.coli-expressed human HSPC152 .

References

ab239546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up