Description

  • Product name

    Recombinant Human hSSB1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSI NISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCM VYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGPSAASPASENQ NGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVS NGKETRRSSKR
    • Amino acids

      1 to 211
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as OBFC2B. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2610036N15Rik
    • hSSB1
    • LP3587
    • MGC125161
    • MGC2731
    • MGC30353
    • Nabp2
    • Nucleic acid binding protein 2
    • OBFC2B
    • Oligonucleotide/oligosaccharide binding fold containing 2B
    • Oligonucleotide/oligosaccharide binding fold containing protein 2B
    • RGD1308158
    • Sensor of single strand DNA complex subunit B1
    • Sensor of ssDNA subunit B1
    • Single stranded DNA binding protein 1
    • SOSS complex subunit B1
    • SSB1
    see all
  • Relevance

    Single-stranded DNA (ssDNA)-binding proteins, such as hSSB1, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage. hSSB1 plays an important role in DNA damage response. It influences diverse endpoints in the cellular DNA damage response, including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. It associates with DNA lesions, and enables the efficient activation of ATM and consequent phosphorylation of downstream proteins.
  • Cellular localization

    Nuclear. Localizes to nuclear foci following DNA damage.

Images

  • ab163963 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up