Description

  • Product name

    Recombinant Human htrA1 protein
    See all htrA1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGAPE GAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSD ANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFI ADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVV TNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSE LRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAI INYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKIKKFLTESHDRQA KGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTP AEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMIT VIPEEIDP
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      23 to 480
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature full length protein corresponding to amino acids 23-480 of human htrA with N terminal His tag.

Specifications

Our Abpromise guarantee covers the use of ab191464 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.02% Imidazole
    Constituents: 0.79% Tris HCl, 1.74% Sodium chloride, 10% Glycerol

General Info

  • Alternative names

    • ARMD7
    • CARASIL
    • High-temperature requirement A serine peptidase 1
    • HtrA
    • HtrA serine peptidase 1
    • HTRA1
    • HTRA1_HUMAN
    • IGFBP5 protease
    • L56
    • ORF480
    • protease serine 11
    • Protease serine 11 (IGF binding)
    • PRSS11
    • Serine protease 11
    • Serine protease HTRA1
    • Serine protease HTRA1 precursor
    see all
  • Function

    Protease that regulate the availability of nsulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Represses signaling by TGF-beta family members.
  • Tissue specificity

    Expressed in a variety of tissues, with strongest expression in placenta.
  • Involvement in disease

    Variations in the promoter region of HTRA1 are the cause of susceptibility to age-related macular degeneration type 7 (ARMD7) [MIM:610149]. ARMD is the leading cause of vision loss and blindness among older individuals in the developed word. It is classified as either dry (nonneovascular) or wet (neovascular). ARMD7 is a wet form, in which new blood vessels form and break beneath the retina. This leakage causes permanent damage to surrounding retinal tissue, distorting and destroying central vision. Wet ARMD is more prevalent among Asians than Caucasians.
    Defects in HTRA1 are the cause of cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL) [MIM:600142]. CARASIL is characterized by nonhypertensive cerebral small-vessel arteriopathy with subcortical infarcts, alopecia, and spondylosis, with an onset in early adulthood. On neuropathological examination, arteriosclerosis associated with intimal thickening and dense collagen fibers, loss of vascular smooth-muscle cells, and hyaline degeneration of the tunica media has been observed in cerebral small arteries.
  • Sequence similarities

    Belongs to the peptidase S1B family.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab191464

References

ab191464 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191464.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up