Description

  • Product name

    Recombinant human htrA4 protein
    See all htrA4 proteins and peptides
  • Biological activity

    Proteolytic activity of ab134444 was documented by digestion of ß- casein. 0.5 mg ß-casein/ml are completely digested by 10 µg/ml htrA4 within 18 hours at 37°C.
  • Purity

    > 70 % SDS-PAGE.

  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MIRPQLRTAGLGRCLLPGLLLLLVPVLWAGAEKLHTQPSCPAVCQPTRCP ALPTCALGTTPVFDLCRCCRVCPAAEREVCGGAQGQPCAPGLQCLQPLRP GFPSTCGCPTLGGAVCGSDRRTYPSMCALRAENRAARRLGKVPAVPVQWG NCGDTGTRSAGPLRRNYNFIAAVVEKVAPSVVHVQLWGRLLHGSRLVPVY SGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVVKDIDLKLDLA VIKIESNAELPVLMLGRSSDLRAGEFVVALGSPFSLQNTATAGIVSTKQR GGKELGMKDSDMDYVQIDATINYGNSGGPLVNLDGDVIGVNSLRVTDGIS FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHY PDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNINGKPITTTTDVVKAL DSDSLSMAVLRGKDNLLLTVIPETINHHHHHH
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      1 to 476
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134444 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Preservative: 0.34% Imidazole
    Constituents: 0.05% Brij, 0.05% Calcium chloride, 0.79% Tris HCl, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • FLJ90724
    • High temperature requirement protean A4
    • High-temperature requirement factor A4
    • HTRA 4
    • HtrA serine peptidase 4
    • HTRA4
    • HTRA4_HUMAN
    • Probable serine protease HTRA4
    • Serine protease HTRA4
    see all
  • Function

    Serine protease.
  • Sequence similarities

    Belongs to the peptidase S1B family.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 Kazal-like domain.
    Contains 1 PDZ (DHR) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab134444 (1.5µg).
  • Hydrolysis of ß-Casein by ab134444. ß-Casein (0.19 mg/ml) was incubated in 50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.5 mM CaCl2 with or without HtrA4 (43.7 µg/ml). After indicated time intervals 4 µl aliquots of the reaction mixtures were withdrawn and analyzed by SDS-PAGE.
    Lane 1: 0 hours
    Lane 2: 2 hours
    Lane 3: 6 hours
    Lane 4: 18 hours

References

ab134444 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134444.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up