Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAK LIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSS
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 100

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ELAV (embryonic lethal abnormal vision Drosophila) like 1
    • ELAV (embryonic lethal, abnormal vision, Drosophila) like 1 (Hu antigen R)
    • ELAV like 1
    • ELAV like RNA binding protein 1
    • ELAV-like protein 1
    • ELAV1
    • ELAV1_HUMAN
    • Elavl1
    • Embryonic lethal abnormal vision drosophila homolog like 1
    • Hu Antigen R
    • Hu-antigen R
    • Hua
    • HuR
    • MelG
    see all
  • Function

    Involved in 3'-UTR ARE-mediated MYC stabilization. Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, HUR binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA and AUUUUUA motifs.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the RRM elav family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Methylated at Arg-217 by CARM1 in macrophages in response to LPS challenge.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152361 stained with Coomassie Blue.

References

ab152361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up