Description

  • Product name

    Recombinant Human HUS1 protein
    See all HUS1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by reducing SDS-PAGE. ab152054 is 0.2 µM filtered.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANG GVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARA LKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPV VPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVC VTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTK ALCNIVNNKMVHFDLLHEDVSLQYFIPALS
    • Predicted molecular weight

      32 kDa
    • Amino acids

      1 to 280

Specifications

Our Abpromise guarantee covers the use of ab152054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Checkpoint protein HUS1
    • hHUS1
    • Hus1
    • HUS1 (S. pombe) checkpoint homolog
    • HUS1 checkpoint homolog (S. pombe)
    • HUS1 Checkpoint Protein
    • HUS1 protein
    • HUS1+ - like protein
    • HUS1_HUMAN
    • Hydroxyurea-sensitive 1, S. pombe, homolog of
    see all
  • Function

    Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the HUS1 family.
  • Cellular localization

    Nucleus. Cytoplasm. In discrete nuclear foci upon DNA damage. According to PubMed:14500360, localized also in the cytoplasm. DNA damage induces its nuclear translocation. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

References

ab152054 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up