Description

  • Product name

    Recombinant Human HYAL1 protein
  • Biological activity

    useful for Antibody Production and Protein Array
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQL GWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLP VLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKES CQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLL NPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERK SMW
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 253
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112304 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Additional notes

    Best use within three months from the date of receipt of this protein.useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names

    • HYAL 1
    • Hyal-1
    • HYAL1
    • HYAL1_HUMAN
    • Hyaluronidase 1
    • Hyaluronidase-1
    • Hyaluronoglucosaminidase 1
    • Hyaluronoglucosaminidase-1
    • Hyaluronoglucosaminidase1
    • LUCA 1
    • LUCA-1
    • LUCA1
    • Lung carcinoma protein 1
    • MGC45987
    • NAT6
    • Plasma hyaluronidase
    • Tumor suppressor LUCA 1
    see all
  • Function

    May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth.
  • Tissue specificity

    Highly expressed in the liver, kidney and heart. Weakly expressed in lung, placenta and skeletal muscle. No expression detected in adult brain. Isoform 1 is expressed only in bladder and prostate cancer cells, G2/G3 bladder tumor tissues and lymph node specimens showing tumor invasive tumors cells. Isoform 3, isoform 4, isoform 5 and isoform 6 are expressed in normal bladder and bladder tumor tissues.
  • Involvement in disease

    Defects in HYAL1 are the cause of mucopolysaccharidosis type 9 (MPS9) [MIM:601492]; also called hyaluronidase deficiency. MPS9 is a lysosomal storage disease characterized by high hyaluronan (HA) concentration in the serum. The clinical features are periarticular soft tissue masses, mild short stature and acetabular erosions, and absence of neurological or visceral involvement.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 56 family.
    Contains 1 EGF-like domain.
  • Cellular localization

    Secreted. Lysosome.
  • Information by UniProt

Images

  • ab112304 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue

References

ab112304 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us. Because we carry over 90,000 products, it isn't feasible for us to keep small sample sizes of our products.

We are happy to reassure our customers that all of our products are covered by our Abpromise, which guarantees that the product will work in the applications and species specified on the datasheet, or we will offer a replacement, credit, or refund within 6 months of purchase.

I hope this information is helpful. Please do not hesitate to contact us again with any other questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up