Overview

  • Product name
    Recombinant Human Hyaluronan synthase 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNN FHEKGPGETDESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRA
    • Amino acids
      102 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HA synthase 2
    • has2
    • HAS2_HUMAN
    • Hyaluronan synthase 2
    • Hyaluronate synthase 2
    • Hyaluronic acid synthase 2
    see all
  • Function
    Plays a role in hyaluronan/hyaluronic acid (HA) synthesis.
  • Tissue specificity
    Expressed in fibroblasts.
  • Pathway
    Glycan biosynthesis; hyaluronan biosynthesis.
  • Involvement in disease
    Note=A chromosomal aberration involving HAS2 may be a cause of lipoblastomas, which are benign tumors resulting from transformation of adipocytes, usually diagnosed in children. 8q12.1 to 8q24.1 intrachromosomal rearrangement with PLAG1.
  • Sequence similarities
    Belongs to the nodC/HAS family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158635 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up